SCOP 1.73: Domain d1fyfb2: 1fyf B:242-532

Lineage for d1fyfb2 (1fyf B:242-532)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)

7. Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)

8. Domain d1fyfb2: 1fyf B:242-532 [40756]
   Other proteins in same PDB: d1fyfa1, d1fyfb1
   complexed with ssa, zn

Details for d1fyfb2

PDB Entry: 1fyf, 1.65 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase complexed with a seryl adenylate analog

PDB Compounds: (B:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1fyfb2:

Sequence; same for both SEQRES and ATOM records:

>d1fyfb2 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d1fyfb2:

• d1fyfb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fyfb2 appears in SCOP 1.71
  
• d1fyfb2 appears in SCOP 1.75
  
• d1fyfb2 appears in the current release, SCOPe 2.08