SCOPe 2.08: Domain d6zood_: 6zoo D:

Lineage for d6zood_ (6zoo D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
   beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail

4. Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family)
   automatically mapped to Pfam PF02531

5. Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)

6. Protein automated matches [236562] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)

8. Domain d6zood_: 6zoo D: [407543]
   Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_, d6zoop_
   automated match to d5l8rd_
   complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zood_

PDB Entry: 6zoo, 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex

PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d6zood_:

Sequence; same for both SEQRES and ATOM records:

>d6zood_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn
llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn
frsigknvspievkftgkqpydl

Timeline for d6zood_:

• d6zood_ first appeared in SCOPe 2.07