Lineage for d1evld2 (1evl D:242-532)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) 
Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species) Species Escherichia coli [TaxId:562] [55695] (5 PDB entries) 
Domain d1evld2: 1evl D:242-532 [40754]
Other proteins in same PDB: d1evla1, d1evlb1, d1evlc1, d1evld1
complexed with tsb, zn
Details for d1evld2
PDB Entry: 1evl (more details), 1.55 Å
PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog
PDB Compounds: (D:) threonyl-tRNA synthetaseSCOPe Domain Sequences for d1evld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evld2 d.104.1.1 (D:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf
SCOPe Domain Coordinates for d1evld2:
Click to download the PDB-style file with coordinates for d1evld2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1evld2:
View in 3D
