Lineage for d6zoop_ (6zoo P:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380621Protein Plastocyanin [49507] (17 species)
  7. 2380669Species Pisum sativum [TaxId:3888] [393665] (2 PDB entries)
  8. 2380670Domain d6zoop_: 6zoo P: [407538]
    Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_
    automated match to d1ag6a_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoop_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (P:) Plastocyanin, chloroplastic

SCOPe Domain Sequences for d6zoop_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zoop_ b.6.1.1 (P:) Plastocyanin {Pisum sativum [TaxId: 3888]}
vevllggddgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d6zoop_:

Click to download the PDB-style file with coordinates for d6zoop_.
(The format of our PDB-style files is described here.)

Timeline for d6zoop_: