| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein Plastocyanin [49507] (17 species) |
| Species Pea (Pisum sativum) [TaxId:3888] [393665] (2 PDB entries) |
| Domain d6zoop_: 6zoo P: [407538] Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_ automated match to d1ag6a_ complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6zoo (more details), 2.74 Å
SCOPe Domain Sequences for d6zoop_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zoop_ b.6.1.1 (P:) Plastocyanin {Pea (Pisum sativum) [TaxId: 3888]}
vevllgasdgglafvpsslevsagetivfknnagfphnvvfdedeipagvdaskismpee
dllnapgetysvkldakgtykfycsphqgagmvgqvtvn
Timeline for d6zoop_: