SCOPe 2.08: Domain d6zoop_: 6zoo P:

Lineage for d6zoop_ (6zoo P:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [393665] (2 PDB entries)

8. Domain d6zoop_: 6zoo P: [407538]
   Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_
   automated match to d1ag6a_
   complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoop_

PDB Entry: 6zoo, 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex

PDB Compounds: (P:) Plastocyanin, chloroplastic

SCOPe Domain Sequences for d6zoop_:

Sequence; same for both SEQRES and ATOM records:

>d6zoop_ b.6.1.1 (P:) Plastocyanin {Pea (Pisum sativum) [TaxId: 3888]}
vevllgasdgglafvpsslevsagetivfknnagfphnvvfdedeipagvdaskismpee
dllnapgetysvkldakgtykfycsphqgagmvgqvtvn

Timeline for d6zoop_:

• d6zoop_ first appeared in SCOPe 2.07