Lineage for d1evlc2 (1evl C:242-532)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608836Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 608837Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 608838Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 608993Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 608994Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
  8. 608998Domain d1evlc2: 1evl C:242-532 [40753]
    Other proteins in same PDB: d1evla1, d1evlb1, d1evlc1, d1evld1

Details for d1evlc2

PDB Entry: 1evl (more details), 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog

SCOP Domain Sequences for d1evlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evlc2 d.104.1.1 (C:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOP Domain Coordinates for d1evlc2:

Click to download the PDB-style file with coordinates for d1evlc2.
(The format of our PDB-style files is described here.)

Timeline for d1evlc2: