Lineage for d6zc8b1 (6zc8 B:246-335)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786243Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)
  8. 2786323Domain d6zc8b1: 6zc8 B:246-335 [407526]
    Other proteins in same PDB: d6zc8a2, d6zc8b2
    automated match to d2kawa_
    complexed with qek

Details for d6zc8b1

PDB Entry: 6zc8 (more details), 2.76 Å

PDB Description: small-molecule inhibitors of the pdz domain of dishevelled proteins interrupt wnt signalling
PDB Compounds: (B:) Segment polarity protein dishevelled homolog DVL-3

SCOPe Domain Sequences for d6zc8b1:

Sequence, based on SEQRES records: (download)

>d6zc8b1 b.36.1.1 (B:246-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvnei
nfenmsnddavrvlreivhkpgpitltvak

Sequence, based on observed residues (ATOM records): (download)

>d6zc8b1 b.36.1.1 (B:246-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqgiyigsimkggavaadgriepgdmllqvneinfenmsn
ddavrvlreivhkpgpitltvak

SCOPe Domain Coordinates for d6zc8b1:

Click to download the PDB-style file with coordinates for d6zc8b1.
(The format of our PDB-style files is described here.)

Timeline for d6zc8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6zc8b2