Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d6zc4b1: 6zc4 B:245-335 [407520] Other proteins in same PDB: d6zc4a2, d6zc4a3, d6zc4b2 automated match to d2kawa_ complexed with qez |
PDB Entry: 6zc4 (more details), 1.85 Å
SCOPe Domain Sequences for d6zc4b1:
Sequence, based on SEQRES records: (download)
>d6zc4b1 b.36.1.1 (B:245-335) automated matches {Homo sapiens [TaxId: 9606]} lniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvne infenmsnddavrvlreivhkpgpitltvak
>d6zc4b1 b.36.1.1 (B:245-335) automated matches {Homo sapiens [TaxId: 9606]} lniitvtlnmekynflgisivgggiyigsimkggavaadgriepgdmllqvneinfenms nddavrvlreivhkpgpitltvak
Timeline for d6zc4b1: