Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species) |
Species Escherichia coli [TaxId:562] [55695] (5 PDB entries) |
Domain d1evlb2: 1evl B:242-532 [40752] Other proteins in same PDB: d1evla1, d1evlb1, d1evlc1, d1evld1 complexed with tsb, zn |
PDB Entry: 1evl (more details), 1.55 Å
SCOPe Domain Sequences for d1evlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evlb2 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf
Timeline for d1evlb2: