Lineage for d6zooa_ (6zoo A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633163Species Pea (Pisum sativum) [TaxId:3888] [276242] (8 PDB entries)
  8. 2633168Domain d6zooa_: 6zoo A: [407514]
    Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zoop_
    automated match to d5l8ra_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zooa_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d6zooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zooa_ f.29.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
pevkilvdrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeis
rkvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndptxirpsaqvvwpivgqeilngd
vgggfrgiqitsgffqiwrasgitselqlyctaigalvfaalmlfagwfhyhkaapklvw
fqdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpkeiplphefilnrdll
aqlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliagh
myrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltiivahh
myamppypylatdygtqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrv
lrhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnt
halapgttapgattstsltwgggdlvsvggkvallpiplgtadflvhhihaftihvtvli
llkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynaisvvifh
fswkmqsdvwgsindqgvvtxitggnfaqssitingwlrdflwaqasqviqsygsslsay
glfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgv
thyllggiattwafflariiavg

SCOPe Domain Coordinates for d6zooa_:

Click to download the PDB-style file with coordinates for d6zooa_.
(The format of our PDB-style files is described here.)

Timeline for d6zooa_: