Lineage for d6zooj_ (6zoo J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631562Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 2631563Protein automated matches [276198] (4 species)
    not a true protein
  7. 2631573Species Pea (Pisum sativum) [TaxId:3888] [276201] (7 PDB entries)
  8. 2631576Domain d6zooj_: 6zoo J: [407512]
    Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zoop_
    automated match to d5l8rj_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zooj_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6zooj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zooj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltfpff

SCOPe Domain Coordinates for d6zooj_:

Click to download the PDB-style file with coordinates for d6zooj_.
(The format of our PDB-style files is described here.)

Timeline for d6zooj_: