Lineage for d1evla2 (1evl A:242-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208749Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 2208750Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
  8. 2208752Domain d1evla2: 1evl A:242-532 [40751]
    Other proteins in same PDB: d1evla1, d1evlb1, d1evlc1, d1evld1
    complexed with tsb, zn

Details for d1evla2

PDB Entry: 1evl (more details), 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1evla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evla2 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d1evla2:

Click to download the PDB-style file with coordinates for d1evla2.
(The format of our PDB-style files is described here.)

Timeline for d1evla2: