SCOP 1.67: Domain d1evla2: 1evl A:242-532

Lineage for d1evla2 (1evl A:242-532)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheet
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
Domain d1evla2: 1evl A:242-532 [40751]
Other proteins in same PDB: d1evla1, d1evlb1, d1evlc1, d1evld1

Details for d1evla2

PDB Entry: 1evl (more details), 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog

SCOP Domain Sequences for d1evla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evla2 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOP Domain Coordinates for d1evla2:

Click to download the PDB-style file with coordinates for d1evla2.
(The format of our PDB-style files is described here.)

Timeline for d1evla2: