Lineage for d6zoob_ (6zoo B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633163Species Pea (Pisum sativum) [TaxId:3888] [276242] (8 PDB entries)
  8. 2633169Domain d6zoob_: 6zoo B: [407509]
    Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zoop_
    automated match to d5l8rb_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoob_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (B:) photosystem I p700 chlorophyll a apoprotein a2

SCOPe Domain Sequences for d6zoob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zoob_ f.29.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
alrfprfsqglaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt
sgnlfhvawqgnfeawvqdplhvrpiahaiwdphfgqpaveaftrggalgpvniaysgvy
qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg
lfgvsslawaghlvhvaipgsrgeyvrwnnflsvlphpqglgplftgqwnlyaqnpdssn
hlfstsqgagtailtllggfhpqtqslwltdmahhhlaiailfligghmyrtnfgighsi
kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi
aqdfttqaalythhqyiagfimtgafahgaiffirdynpeqnadnvlarmlehkeaiish
lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsst
nspalnagrsiwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda
rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhitl
wqgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatgf
mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty
aafliastsgkfg

SCOPe Domain Coordinates for d6zoob_:

Click to download the PDB-style file with coordinates for d6zoob_.
(The format of our PDB-style files is described here.)

Timeline for d6zoob_: