| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
| Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
| Protein automated matches [276200] (4 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries) |
| Domain d6zoo1_: 6zoo 1: [407503] Other proteins in same PDB: d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_, d6zoop_ automated match to d5l8r1_ complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6zoo (more details), 2.74 Å
SCOPe Domain Sequences for d6zoo1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zoo1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
dwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpea
lglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkk
ypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathla
dpwhntignvlip
Timeline for d6zoo1_: