SCOPe 2.03: Domain d1ggmb2: 1ggm B:1-394

Lineage for d1ggmb2 (1ggm B:1-394)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)

8. Domain d1ggmb2: 1ggm B:1-394 [40750]
   Other proteins in same PDB: d1ggma1, d1ggmb1
   protein/RNA complex; complexed with gap

Details for d1ggmb2

PDB Entry: 1ggm, 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate

PDB Compounds: (B:) protein (glycyl-tRNA synthetase)

SCOPe Domain Sequences for d1ggmb2:

Sequence; same for both SEQRES and ATOM records:

>d1ggmb2 d.104.1.1 (B:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
vdrgvlallaeaftreelpngeerivlklkp

Timeline for d1ggmb2:

• d1ggmb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ggmb2 appears in SCOPe 2.02
  
• d1ggmb2 appears in SCOPe 2.04
  
• d1ggmb2 appears in the current release, SCOPe 2.08