Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries) |
Domain d6zc6a1: 6zc6 A:243-335 [407495] Other proteins in same PDB: d6zc6a2 automated match to d2kawa_ complexed with edo, qen |
PDB Entry: 6zc6 (more details), 1.58 Å
SCOPe Domain Sequences for d6zc6a1:
Sequence, based on SEQRES records: (download)
>d6zc6a1 b.36.1.1 (A:243-335) automated matches {Human (Homo sapiens) [TaxId: 9606]} mslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqv neinfenmsnddavrvlreivhkpgpitltvak
>d6zc6a1 b.36.1.1 (A:243-335) automated matches {Human (Homo sapiens) [TaxId: 9606]} mslniitvtlnmekynflgisivgqsnegiyigsimkggavaadgriepgdmllqvnein fenmsnddavrvlreivhkpgpitltvak
Timeline for d6zc6a1: