Lineage for d6xvuc_ (6xvu C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855927Species Deinococcus radiodurans [TaxId:243230] [407321] (1 PDB entry)
  8. 2855930Domain d6xvuc_: 6xvu C: [407484]
    automated match to d1jlka_
    complexed with ca

Details for d6xvuc_

PDB Entry: 6xvu (more details), 2.1 Å

PDB Description: bacteriophytochrome response regulator from deinococcus radiodurans
PDB Compounds: (C:) Response regulator

SCOPe Domain Sequences for d6xvuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xvuc_ c.23.1.0 (C:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
vplrlllvednaadiflmemaleyssvhtellvardglealelleqaktggpfpdlilld
lnmprvdgfellqalradphlahlpaivlttsndpsdvkrayalqansyltkpstledfl
qlierltaywfgtaaipqt

SCOPe Domain Coordinates for d6xvuc_:

Click to download the PDB-style file with coordinates for d6xvuc_.
(The format of our PDB-style files is described here.)

Timeline for d6xvuc_: