Lineage for d1b76b2 (1b76 B:1-394)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208606Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)
  7. 2208607Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)
  8. 2208611Domain d1b76b2: 1b76 B:1-394 [40748]
    Other proteins in same PDB: d1b76a1, d1b76b1
    protein/RNA complex; complexed with atp

Details for d1b76b2

PDB Entry: 1b76 (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with atp
PDB Compounds: (B:) protein (glycyl-tRNA synthetase)

SCOPe Domain Sequences for d1b76b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b76b2 d.104.1.1 (B:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
vdrgvlallaeaftreelpngeerivlklkp

SCOPe Domain Coordinates for d1b76b2:

Click to download the PDB-style file with coordinates for d1b76b2.
(The format of our PDB-style files is described here.)

Timeline for d1b76b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b76b1