SCOPe 2.07: Domain d6zbqa1: 6zbq A:243-335

Lineage for d6zbqa1 (6zbq A:243-335)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)

8. Domain d6zbqa1: 6zbq A:243-335 [407477]
   Other proteins in same PDB: d6zbqa2, d6zbqa3, d6zbqb2
   automated match to d2kawa_
   complexed with qe2

Details for d6zbqa1

PDB Entry: 6zbq, 1.43 Å

PDB Description: small-molecule inhibitors of the pdz domain of dishevelled proteins interrupt wnt signalling

PDB Compounds: (A:) Dishevelled, dsh homolog 3 (Drosophila), isoform CRA_b

SCOPe Domain Sequences for d6zbqa1:

Sequence, based on SEQRES records:

>d6zbqa1 b.36.1.1 (A:243-335) automated matches {Homo sapiens [TaxId: 9606]}
mslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqv
neinfenmsnddavrvlreivhkpgpitltvak

Sequence, based on observed residues (ATOM records):

>d6zbqa1 b.36.1.1 (A:243-335) automated matches {Homo sapiens [TaxId: 9606]}
mslniitvtlnmekynflgisivgqggiyigsimkggavaadgriepgdmllqvneinfe
nmsnddavrvlreivhkpgpitltvak

Timeline for d6zbqa1:

• d6zbqa1 is new in SCOPe 2.07-stable
  
• d6zbqa1 appears in the current release, SCOPe 2.08