Lineage for d1atia2 (1ati A:1-394)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920729Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)
  7. 1920730Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)
  8. 1920731Domain d1atia2: 1ati A:1-394 [40745]
    Other proteins in same PDB: d1atia1, d1atib1

Details for d1atia2

PDB Entry: 1ati (more details), 2.75 Å

PDB Description: crystal structure of glycyl-trna synthetase from thermus thermophilus
PDB Compounds: (A:) GLYCYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1atia2:

Sequence, based on SEQRES records: (download)

>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
sagvdrgvlallaeaftreelpngeerivlklkp

Sequence, based on observed residues (ATOM records): (download)

>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnwtppryfnmmfqdlrgprggrgllaylrpe
taqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyfvrpge
deywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgslelegi
aqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsagvdrgv
lallaeaftreelpngeerivlklkp

SCOPe Domain Coordinates for d1atia2:

Click to download the PDB-style file with coordinates for d1atia2.
(The format of our PDB-style files is described here.)

Timeline for d1atia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1atia1