Lineage for d1adyd2 (1ady D:2-325)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) 
Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species) Species Thermus thermophilus [TaxId:274] [55691] (3 PDB entries) 
Domain d1adyd2: 1ady D:2-325 [40744]
Other proteins in same PDB: d1adya1, d1adyb1, d1adyc1, d1adyd1
protein/RNA complex; complexed with ham, so4
Details for d1adyd2
PDB Entry: 1ady (more details), 2.8 Å
PDB Description: histidyl-trna synthetase in complex with histidyl-adenylate
PDB Compounds: (D:) histidyl-tRNA synthetaseSCOPe Domain Sequences for d1adyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adyd2 d.104.1.1 (D:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]}
taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
gvgfafgvervalaleaegfglpe
SCOPe Domain Coordinates for d1adyd2:
Click to download the PDB-style file with coordinates for d1adyd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1adyd2:
View in 3D
