Lineage for d1adyd2 (1ady D:2-325)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967689Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species)
  7. 2967713Species Thermus thermophilus [TaxId:274] [55691] (3 PDB entries)
  8. 2967722Domain d1adyd2: 1ady D:2-325 [40744]
    Other proteins in same PDB: d1adya1, d1adyb1, d1adyc1, d1adyd1
    protein/RNA complex; complexed with ham, so4
    has additional subdomain(s) that are not in the common domain

Details for d1adyd2

PDB Entry: 1ady (more details), 2.8 Å

PDB Description: histidyl-trna synthetase in complex with histidyl-adenylate
PDB Compounds: (D:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1adyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adyd2 d.104.1.1 (D:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]}
taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
gvgfafgvervalaleaegfglpe

SCOPe Domain Coordinates for d1adyd2:

Click to download the PDB-style file with coordinates for d1adyd2.
(The format of our PDB-style files is described here.)

Timeline for d1adyd2: