Lineage for d6zc4a1 (6zc4 A:243-335)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395899Domain d6zc4a1: 6zc4 A:243-335 [407436]
    Other proteins in same PDB: d6zc4a2, d6zc4a3, d6zc4b2
    automated match to d2kawa_
    complexed with qez

Details for d6zc4a1

PDB Entry: 6zc4 (more details), 1.85 Å

PDB Description: small-molecule inhibitors of the pdz domain of dishevelled proteins interrupt wnt signalling
PDB Compounds: (A:) Dishevelled, dsh homolog 3 (Drosophila), isoform CRA_b

SCOPe Domain Sequences for d6zc4a1:

Sequence, based on SEQRES records: (download)

>d6zc4a1 b.36.1.1 (A:243-335) automated matches {Homo sapiens [TaxId: 9606]}
mslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqv
neinfenmsnddavrvlreivhkpgpitltvak

Sequence, based on observed residues (ATOM records): (download)

>d6zc4a1 b.36.1.1 (A:243-335) automated matches {Homo sapiens [TaxId: 9606]}
mslniitvtlnmekynflgisivgqgiyigsimkggavaadgriepgdmllqvneinfen
msnddavrvlreivhkpgpitltvak

SCOPe Domain Coordinates for d6zc4a1:

Click to download the PDB-style file with coordinates for d6zc4a1.
(The format of our PDB-style files is described here.)

Timeline for d6zc4a1: