Lineage for d6zc5k_ (6zc5 K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386588Species Human adenovirus d10 [TaxId:28275] [407427] (1 PDB entry)
  8. 2386599Domain d6zc5k_: 6zc5 K: [407428]
    automated match to d1qhva_

Details for d6zc5k_

PDB Entry: 6zc5 (more details), 2.5 Å

PDB Description: human adenovirus serotype d10 fiberknob protein
PDB Compounds: (K:) Fiber

SCOPe Domain Sequences for d6zc5k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zc5k_ b.21.1.1 (K:) Adenovirus fiber protein "knob" domain {Human adenovirus d10 [TaxId: 28275]}
hdtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnknnpe
iksftikllfdkngvlldnsnlgktywnfrsgdsnvstayekaigfmpnlvaypkpsnsk
kyardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenvefettsftfs
yiaqq

SCOPe Domain Coordinates for d6zc5k_:

Click to download the PDB-style file with coordinates for d6zc5k_.
(The format of our PDB-style files is described here.)

Timeline for d6zc5k_: