SCOPe 2.07: Domain d6xq0c2: 6xq0 C:107-212

Lineage for d6xq0c2 (6xq0 C:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6xq0c2: 6xq0 C:107-212 [407417]
   Other proteins in same PDB: d6xq0c1, d6xq0f1
   automated match to d1dn0a2
   complexed with gol

Details for d6xq0c2

PDB Entry: 6xq0, 2.3 Å

PDB Description: human antibody s8v2-18 in complex with the influenza hemagglutinin head domain of a/california/7/2009(nymc-x181)(h1n1)

PDB Compounds: (C:) antibody S8V2-18 light chain

SCOPe Domain Sequences for d6xq0c2:

Sequence; same for both SEQRES and ATOM records:

>d6xq0c2 b.1.1.2 (C:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6xq0c2:

• d6xq0c2 is new in SCOPe 2.07-stable
  
• d6xq0c2 appears in the current release, SCOPe 2.08