SCOPe 2.08: Domain d6zbzb1: 6zbz B:244-335

Lineage for d6zbzb1 (6zbz B:244-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)

8. Domain d6zbzb1: 6zbz B:244-335 [407406]
   Other proteins in same PDB: d6zbza2, d6zbzb2, d6zbzc2, d6zbzd2
   automated match to d2kawa_
   complexed with edo, qe5

Details for d6zbzb1

PDB Entry: 6zbz, 1.6 Å

PDB Description: small-molecule inhibitors of the pdz domain of dishevelled proteins interrupt wnt signalling

PDB Compounds: (B:) Dishevelled, dsh homolog 3 (Drosophila), isoform CRA_b

SCOPe Domain Sequences for d6zbzb1:

Sequence; same for both SEQRES and ATOM records:

>d6zbzb1 b.36.1.1 (B:244-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvn
einfenmsnddavrvlreivhkpgpitltvak

Timeline for d6zbzb1:

• d6zbzb1 first appeared in SCOPe 2.07