Lineage for d1adjd2 (1adj D:2-325)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) 
Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species) Species Thermus thermophilus [TaxId:274] [55691] (3 PDB entries) 
Domain d1adjd2: 1adj D:2-325 [40740]
Other proteins in same PDB: d1adja1, d1adjb1, d1adjc1, d1adjd1
protein/RNA complex; complexed with his, so4
Details for d1adjd2
PDB Entry: 1adj (more details), 2.7 Å
PDB Description: histidyl-trna synthetase in complex with histidine
PDB Compounds: (D:) histidyl-tRNA synthetaseSCOPe Domain Sequences for d1adjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adjd2 d.104.1.1 (D:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]}
taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
gvgfafgvervalaleaegfglpe
SCOPe Domain Coordinates for d1adjd2:
Click to download the PDB-style file with coordinates for d1adjd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1adjd2:
View in 3D
