Lineage for d6xpoa2 (6xpo A:332-502)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646526Species Influenza a virus (strain a/bangkok/1/1979 h3n2) [TaxId:385630] [407370] (1 PDB entry)
  8. 2646527Domain d6xpoa2: 6xpo A:332-502 [407391]
    Other proteins in same PDB: d6xpoa1, d6xpob1, d6xpoc1
    automated match to d5k9kf2
    complexed with nag

Details for d6xpoa2

PDB Entry: 6xpo (more details), 3 Å

PDB Description: influenza hemagglutinin a/bangkok/01/1979(h3n2)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6xpoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xpoa2 h.3.1.0 (A:332-502) automated matches {Influenza a virus (strain a/bangkok/1/1979 h3n2) [TaxId: 385630]}
fgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnek
fhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfekt
rrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6xpoa2:

Click to download the PDB-style file with coordinates for d6xpoa2.
(The format of our PDB-style files is described here.)

Timeline for d6xpoa2:

2646527
d6xpoa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6xpoa1