Lineage for d1adjc2 (1adj C:2-325)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869604Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 869605Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 869606Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 869676Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species)
  7. 869700Species Thermus thermophilus [TaxId:274] [55691] (3 PDB entries)
  8. 869704Domain d1adjc2: 1adj C:2-325 [40739]
    Other proteins in same PDB: d1adja1, d1adjb1, d1adjc1, d1adjd1

Details for d1adjc2

PDB Entry: 1adj (more details), 2.7 Å

PDB Description: histidyl-trna synthetase in complex with histidine
PDB Compounds: (C:) histidyl-tRNA synthetase

SCOP Domain Sequences for d1adjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adjc2 d.104.1.1 (C:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]}
taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
gvgfafgvervalaleaegfglpe

SCOP Domain Coordinates for d1adjc2:

Click to download the PDB-style file with coordinates for d1adjc2.
(The format of our PDB-style files is described here.)

Timeline for d1adjc2: