SCOPe 2.08: Domain d6z2cb1: 6z2c B:3-178

Lineage for d6z2cb1 (6z2c B:3-178)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)

8. Domain d6z2cb1: 6z2c B:3-178 [407381]
   Other proteins in same PDB: d6z2ca2, d6z2cb2
   automated match to d1ngla_
   complexed with q5e

Details for d6z2cb1

PDB Entry: 6z2c, 1.8 Å

PDB Description: engineered lipocalin c3a5 in complex with a transition state analog

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d6z2cb1:

Sequence; same for both SEQRES and ATOM records:

>d6z2cb1 b.60.1.1 (B:3-178) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
stsdlipapplskvplqqnfqdnqfhgkwyvvgmagngdlredkdpykmratiyelkedk
synvtwvwflpkkckyfintfvpgsqpgeftlgliksypgqtsllvrvvstnynqhamvf
fktviqnrerfyitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d6z2cb1:

• d6z2cb1 first appeared in SCOPe 2.07