SCOPe 2.07: Domain d6xl8b_: 6xl8 B:

Lineage for d6xl8b_ (6xl8 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d6xl8b_: 6xl8 B: [407352]
   automated match to d1zrha_
   complexed with a3p, bdp, gns, ids, iod, na, npo

Details for d6xl8b_

PDB Entry: 6xl8, 2.34 Å

PDB Description: crystal structure of 3-o-sulfotransferase isoform 3 in complex with 8mer oligosaccharide with no 6s sulfation

PDB Compounds: (B:) Heparan sulfate glucosamine 3-O-sulfotransferase 3A1

SCOPe Domain Sequences for d6xl8b_:

Sequence; same for both SEQRES and ATOM records:

>d6xl8b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skqlpqaiiigvkkggtralleflrvhpdvravgaephffdrsydkglawyrdlmprtld
gqitmektpsyfvtreaparisamskdtklivvvrdpvtraisdytqtlskrpdiptfes
ltfknrtaglidtswsaiqigiyakhlehwlrhfpirqmlfvsgerlisdpagelgrvqd
flglkriitdkhfyfnktkgfpclkkaegssrphclgktkgrthpeidrevvrrlrefyr
pfnlkfyqmtghdfgwd

Timeline for d6xl8b_:

• d6xl8b_ is new in SCOPe 2.07-stable
  
• d6xl8b_ appears in the current release, SCOPe 2.08