Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus [TaxId:387139] [369088] (2 PDB entries) |
Domain d6xpxa_: 6xpx A: [407349] Other proteins in same PDB: d6xpxb_, d6xpxc1, d6xpxc2 automated match to d3s13a_ complexed with 1pe, bcn, gol, nag |
PDB Entry: 6xpx (more details), 2.6 Å
SCOPe Domain Sequences for d6xpxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xpxa_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 387139]} elvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypy dvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgst ypvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipnigsr pwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcise citpngsipndkpfqnvnkitygacpkyvkq
Timeline for d6xpxa_: