Lineage for d6xk5a_ (6xk5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2610000Protein automated matches [190421] (6 species)
    not a true protein
  7. 2610006Species Bacillus subtilis [TaxId:224308] [228529] (75 PDB entries)
  8. 2610014Domain d6xk5a_: 6xk5 A: [407316]
    automated match to d4d3ia_
    complexed with cl, gol, hem, v4y

Details for d6xk5a_

PDB Entry: 6xk5 (more details), 1.87 Å

PDB Description: nitric oxide synthase from bacillus subtilis in complex with 7-((3- (((4-(6-aminopyridin-2-yl)butyl)amino)methyl)phenoxy)methyl)quinolin- 2-amine
PDB Compounds: (A:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d6xk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xk5a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

SCOPe Domain Coordinates for d6xk5a_:

Click to download the PDB-style file with coordinates for d6xk5a_.
(The format of our PDB-style files is described here.)

Timeline for d6xk5a_: