Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein automated matches [190421] (6 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [228529] (75 PDB entries) |
Domain d6xk7a_: 6xk7 A: [407308] automated match to d4d3ia_ complexed with cl, gol, hem, pol, v5g |
PDB Entry: 6xk7 (more details), 1.85 Å
SCOPe Domain Sequences for d6xk7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xk7a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp ye
Timeline for d6xk7a_: