Lineage for d6x7ra1 (6x7r A:1-174)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524395Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species)
  7. 2524396Species Escherichia coli [TaxId:316385] [407256] (1 PDB entry)
  8. 2524397Domain d6x7ra1: 6x7r A:1-174 [407257]
    Other proteins in same PDB: d6x7ra3
    automated match to d1hnja1
    complexed with dms, mg, ut7

Details for d6x7ra1

PDB Entry: 6x7r (more details), 1.35 Å

PDB Description: e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) in complex with oxa(dethia)-coenzyme a
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d6x7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x7ra1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 316385]}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

SCOPe Domain Coordinates for d6x7ra1:

Click to download the PDB-style file with coordinates for d6x7ra1.
(The format of our PDB-style files is described here.)

Timeline for d6x7ra1: