Lineage for d6x2qa_ (6x2q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926532Species Gynuella sunshinyii [TaxId:1445510] [399757] (2 PDB entries)
  8. 2926533Domain d6x2qa_: 6x2q A: [407246]
    automated match to d1chka_
    complexed with gcs

Details for d6x2qa_

PDB Entry: 6x2q (more details), 2.27 Å

PDB Description: complex of gynuella sunshinyii gh46 chitosanase gscsn46a with chitotetraose
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d6x2qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x2qa_ d.2.1.0 (A:) automated matches {Gynuella sunshinyii [TaxId: 1445510]}
qltaqqrlladqiisifanntpelqygyaevlddgrgitagragftsatgdmleviqrys
rlrpdnilvpflprlqqlaasedgsieglqglpqrwadasqnpvfrqvqddvvdelyfqp
ameraaelgaqmpltllalydaiiqhgegddgdglpamiarttakvngipaegvderrwl
ktflkirkqvlrhpanletedewsestgrvdslmkllkqgntdlhppiristwgdvfilp
ir

SCOPe Domain Coordinates for d6x2qa_:

Click to download the PDB-style file with coordinates for d6x2qa_.
(The format of our PDB-style files is described here.)

Timeline for d6x2qa_: