Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (18 species) not a true protein |
Species Gynuella sunshinyii [TaxId:1445510] [399757] (2 PDB entries) |
Domain d6x2qa_: 6x2q A: [407246] automated match to d1chka_ complexed with gcs |
PDB Entry: 6x2q (more details), 2.27 Å
SCOPe Domain Sequences for d6x2qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x2qa_ d.2.1.0 (A:) automated matches {Gynuella sunshinyii [TaxId: 1445510]} qltaqqrlladqiisifanntpelqygyaevlddgrgitagragftsatgdmleviqrys rlrpdnilvpflprlqqlaasedgsieglqglpqrwadasqnpvfrqvqddvvdelyfqp ameraaelgaqmpltllalydaiiqhgegddgdglpamiarttakvngipaegvderrwl ktflkirkqvlrhpanletedewsestgrvdslmkllkqgntdlhppiristwgdvfilp ir
Timeline for d6x2qa_: