SCOPe 2.07: Domain d6wu7a_: 6wu7 A:

Lineage for d6wu7a_ (6wu7 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (56 PDB entries)

8. Domain d6wu7a_: 6wu7 A: [407235]
   automated match to d2lcpa_
   complexed with act, ca

Details for d6wu7a_

PDB Entry: 6wu7, 1.84 Å

PDB Description: human calcium and integrin binding protein 3 e150q k151h

PDB Compounds: (A:) Calcium and integrin-binding family member 3

SCOPe Domain Sequences for d6wu7a_:

Sequence; same for both SEQRES and ATOM records:

>d6wu7a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtvftheqleayqdctfftrkeimrlfyryqdlapqlvpldyttcpdvkvpyeligsmpe
lkdnpfrqriaqvfsedgdghmtldnfldmfsvmsemaprdlkayyafkiydfnnddyic
awdleqtvtkltrgelsaeevslvcqhvldeadgdhdgrlsledfqnmilrapdflstfh
i

Timeline for d6wu7a_:

• d6wu7a_ is new in SCOPe 2.07-stable
  
• d6wu7a_ appears in the current release, SCOPe 2.08