Lineage for d1bbua2 (1bbu A:161-502)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260809Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 260810Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 260811Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 260881Protein Lysyl-tRNA synthetase (LysRS) [55685] (2 species)
    contains an insertion of LEM/SAP-like HeH motif, residues 337-379
  7. 260882Species Escherichia coli, gene lysS [TaxId:562] [55687] (2 PDB entries)
  8. 260883Domain d1bbua2: 1bbu A:161-502 [40721]
    Other proteins in same PDB: d1bbua1
    complexed with lys

Details for d1bbua2

PDB Entry: 1bbu (more details), 2.7 Å

PDB Description: lysyl-trna synthetase (lyss) complexed with lysine

SCOP Domain Sequences for d1bbua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbua2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS}
dqearyrqryldlisndesrntfkvrsqilsgirqfmvnrgfmevetpmmqvipggaaar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadykdlielteslfrtlaqdilgktevtygdvtldfgkpfekltmreaikkyrpetd
madldnfdsakaiaesigihvekswglgrivteifeevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaqrfldqvaakdagddeamfydedy
vtalehglpptaglgigidrmvmlftnshtirdvilfpamrp

SCOP Domain Coordinates for d1bbua2:

Click to download the PDB-style file with coordinates for d1bbua2.
(The format of our PDB-style files is described here.)

Timeline for d1bbua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbua1