SCOPe 2.03: Domain d1lylc2: 1lyl C:161-502

Lineage for d1lylc2 (1lyl C:161-502)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Lysyl-tRNA synthetase (LysRS) [55685] (3 species)
   contains an insertion of LEM/SAP-like HeH motif, residues 337-379

7. Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)

8. Domain d1lylc2: 1lyl C:161-502 [40719]
   Other proteins in same PDB: d1lyla1, d1lylb1, d1lylc1
   protein/RNA complex; complexed with lys

Details for d1lylc2

PDB Entry: 1lyl, 2.8 Å

PDB Description: lysyl-trna synthetase (lysu) (e.c.6.1.1.6) complexed with lysine

PDB Compounds: (C:) lysyl-tRNA synthetase (lysu)

SCOPe Domain Sequences for d1lylc2:

Sequence; same for both SEQRES and ATOM records:

>d1lylc2 d.104.1.1 (C:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

Timeline for d1lylc2:

• d1lylc2 first appeared (with stable ids) in SCOP 1.55
  
• d1lylc2 appears in SCOPe 2.02
  
• d1lylc2 appears in SCOPe 2.04
  
• d1lylc2 appears in the current release, SCOPe 2.08