Lineage for d1lylc2 (1lyl C:161-502)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 35013Protein Lysyl-tRNA synthetase (LysRS) [55685] (2 species)
  7. 35017Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)
  8. 35023Domain d1lylc2: 1lyl C:161-502 [40719]
    Other proteins in same PDB: d1lyla1, d1lylb1, d1lylc1

Details for d1lylc2

PDB Entry: 1lyl (more details), 2.8 Å

PDB Description: lysyl-trna synthetase (lysu) (e.c.6.1.1.6) complexed with lysine

SCOP Domain Sequences for d1lylc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lylc2 d.104.1.1 (C:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

SCOP Domain Coordinates for d1lylc2:

Click to download the PDB-style file with coordinates for d1lylc2.
(The format of our PDB-style files is described here.)

Timeline for d1lylc2: