Lineage for d1lyla2 (1lyl A:161-502)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967726Protein Lysyl-tRNA synthetase (LysRS) [55685] (3 species)
    contains an insertion of LEM/SAP-like HeH motif, residues 337-379
  7. 2967730Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)
  8. 2967734Domain d1lyla2: 1lyl A:161-502 [40717]
    Other proteins in same PDB: d1lyla1, d1lylb1, d1lylc1
    protein/RNA complex; complexed with lys
    has additional subdomain(s) that are not in the common domain

Details for d1lyla2

PDB Entry: 1lyl (more details), 2.8 Å

PDB Description: lysyl-trna synthetase (lysu) (e.c.6.1.1.6) complexed with lysine
PDB Compounds: (A:) lysyl-tRNA synthetase (lysu)

SCOPe Domain Sequences for d1lyla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lyla2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

SCOPe Domain Coordinates for d1lyla2:

Click to download the PDB-style file with coordinates for d1lyla2.
(The format of our PDB-style files is described here.)

Timeline for d1lyla2: