Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Lysyl-tRNA synthetase (LysRS) [55685] (3 species) contains an insertion of LEM/SAP-like HeH motif, residues 337-379 |
Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries) |
Domain d1lyla2: 1lyl A:161-502 [40717] Other proteins in same PDB: d1lyla1, d1lylb1, d1lylc1 protein/RNA complex; complexed with lys has additional subdomain(s) that are not in the common domain |
PDB Entry: 1lyl (more details), 2.8 Å
SCOPe Domain Sequences for d1lyla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lyla2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp
Timeline for d1lyla2:
View in 3D Domains from other chains: (mouse over for more information) d1lylb1, d1lylb2, d1lylc1, d1lylc2 |