SCOPe 2.06: Domain d1e24a2: 1e24 A:161-502

Lineage for d1e24a2 (1e24 A:161-502)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Lysyl-tRNA synthetase (LysRS) [55685] (3 species)
   contains an insertion of LEM/SAP-like HeH motif, residues 337-379

7. Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)

8. Domain d1e24a2: 1e24 A:161-502 [40716]
   Other proteins in same PDB: d1e24a1
   protein/RNA complex; complexed with atp, gol, lys, mn

Details for d1e24a2

PDB Entry: 1e24, 2.35 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and atp and mn2+

PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d1e24a2:

Sequence; same for both SEQRES and ATOM records:

>d1e24a2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

Timeline for d1e24a2:

• d1e24a2 first appeared (with stable ids) in SCOP 1.55
  
• d1e24a2 appears in SCOPe 2.05
  
• d1e24a2 appears in SCOPe 2.07
  
• d1e24a2 appears in the current release, SCOPe 2.08