Lineage for d1e24a2 (1e24 A:161-502)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82887Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 82888Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 82889Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 82965Protein Lysyl-tRNA synthetase (LysRS) [55685] (2 species)
  7. 82969Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)
  8. 82972Domain d1e24a2: 1e24 A:161-502 [40716]
    Other proteins in same PDB: d1e24a1

Details for d1e24a2

PDB Entry: 1e24 (more details), 2.35 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and atp and mn2+

SCOP Domain Sequences for d1e24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e24a2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

SCOP Domain Coordinates for d1e24a2:

Click to download the PDB-style file with coordinates for d1e24a2.
(The format of our PDB-style files is described here.)

Timeline for d1e24a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e24a1