SCOPe 2.08: Domain d5s5hb2: 5s5h B:246-437

Lineage for d5s5hb2 (5s5h B:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d5s5hb2: 5s5h B:246-437 [407155]
   Other proteins in same PDB: d5s5ha1, d5s5hb1, d5s5hc1, d5s5hd1, d5s5he_, d5s5hf1, d5s5hf2, d5s5hf3
   automated match to d3rycd2
   complexed with acp, ca, gdp, gtp, mes, mg, wlg

Details for d5s5hb2

PDB Entry: 5s5h, 2.5 Å

PDB Description: tubulin-z2074076908-complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5hb2:

Sequence, based on SEQRES records:

>d5s5hb2 d.79.2.1 (B:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

Sequence, based on observed residues (ATOM records):

>d5s5hb2 d.79.2.1 (B:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrqqyraltvpeltqqmfdsknmmaacdp
rhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa
tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy
qd

Timeline for d5s5hb2:

• d5s5hb2 first appeared in SCOPe 2.07