Lineage for d1e22a2 (1e22 A:161-502)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 35013Protein Lysyl-tRNA synthetase (LysRS) [55685] (2 species)
  7. 35017Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)
  8. 35019Domain d1e22a2: 1e22 A:161-502 [40715]
    Other proteins in same PDB: d1e22a1

Details for d1e22a2

PDB Entry: 1e22 (more details), 2.43 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and the non-hydrolysable atp analogue amp-pcp

SCOP Domain Sequences for d1e22a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e22a2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

SCOP Domain Coordinates for d1e22a2:

Click to download the PDB-style file with coordinates for d1e22a2.
(The format of our PDB-style files is described here.)

Timeline for d1e22a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e22a1