Lineage for d1e22a2 (1e22 A:161-502)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins) 
Protein Lysyl-tRNA synthetase (LysRS) [55685] (2 species) Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries) 
Domain d1e22a2: 1e22 A:161-502 [40715]
Other proteins in same PDB: d1e22a1
Details for d1e22a2
PDB Entry: 1e22 (more details), 2.43 Å
PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and the non-hydrolysable atp analogue amp-pcp
SCOP Domain Sequences for d1e22a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e22a2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp
SCOP Domain Coordinates for d1e22a2:
Click to download the PDB-style file with coordinates for d1e22a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e22a2:
- d1e22a2 appears in SCOP 1.57
- d1e22a2 appears in the current release, SCOPe 2.08
View in 3D
