Lineage for d1e1oa2 (1e1o A:161-502)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. Protein Lysyl-tRNA synthetase (LysRS) [55685] (3 species)
    contains an insertion of LEM/SAP-like HeH motif, residues 337-379
  7. Species Escherichia coli, gene lysU [TaxId:562] [55686] (5 PDB entries)
  8. Domain d1e1oa2: 1e1o A:161-502 [40714]
    Other proteins in same PDB: d1e1oa1
    protein/RNA complex; complexed with gol, lys
    has additional subdomain(s) that are not in the common domain

Details for d1e1oa2

PDB Entry: 1e1o (more details), 2.12 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form, complexed with lysine
PDB Compounds: (A:) lysyl-tRNA synthetase, heat inducible

SCOPe Domain Sequences for d1e1oa2:

Sequence, based on SEQRES records: (download)

>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvrhnpeftmmely
mayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetd
madldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevspla
rrndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedy
vtaleyglpptaglgigidrmimlftnshtirdvilfpamrp

Sequence, based on observed residues (ATOM records): (download)

>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
dqevryrqryldliandksrqtfvvrskilaairqfmvargfmevetpmmqvipggasar
pfithhnaldldmylriapelylkrlvvggfervfeinrnfrnegisvhnpeftmmelym
ayadyhdlielteslfrtlaqevlgttkvtygehvfdfgkpfekltmreaikkyrpetdm
adldnfdaakalaesigitvekswglgrivteifdevaeahliqptfiteypaevsplar
rndvnpeitdrfeffiggreigngfselndaedqaerfqeqvnakaagddeamfydedyv
taleyglpptaglgigidrmimlftnshtirdvilfpamrp

SCOPe Domain Coordinates for d1e1oa2 are not available.

Timeline for d1e1oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1oa1