Lineage for d1cbya_ (1cby A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967596Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. 2967597Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) (S)
  5. 2967598Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
    Pfam PF01338
  6. 2967599Protein Mosquitocidal delta-endotoxin CytB [55678] (1 species)
  7. 2967600Species Bacillus thuringiensis, strain Kyushuensis [TaxId:1428] [55679] (1 PDB entry)
  8. 2967601Domain d1cbya_: 1cby A: [40705]

Details for d1cbya_

PDB Entry: 1cby (more details), 2.6 Å

PDB Description: delta-endotoxin
PDB Compounds: (A:) delta-endotoxin cytb

SCOPe Domain Sequences for d1cbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbya_ d.103.1.1 (A:) Mosquitocidal delta-endotoxin CytB {Bacillus thuringiensis, strain Kyushuensis [TaxId: 1428]}
csapiirkpfkhivltvpssdldnfntvfyvqpqyinqalhlanafqgaidplnlnfnfe
kalqiangipnsaivktlnqsviqqtveisvmveqlkkiiqevlglvinstsfwnsveat
ikgtftnldtqideawifwhslsahntsyyynilfsiqnedtgavmavlplafevsvdve
kqkvlfftikdsaryevkmkaltlvqalhssnapivdifnvnnynly

SCOPe Domain Coordinates for d1cbya_:

Click to download the PDB-style file with coordinates for d1cbya_.
(The format of our PDB-style files is described here.)

Timeline for d1cbya_: