SCOP 1.67: Domain d2nef__: 2nef -

Lineage for d2nef__ (2nef -)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (1 family)

5. Family d.102.1.1: Regulatory factor Nef [55672] (1 protein)

6. Protein Regulatory factor Nef [55673] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)

8. Domain d2nef__: 2nef - [40704]
   mutant

Details for d2nef__

PDB Entry: 2nef

PDB Description: hiv-1 nef (regulatory factor), nmr, 40 structures

SCOP Domain Sequences for d2nef__:

Sequence; same for both SEQRES and ATOM records:

>d2nef__ d.102.1.1 (-) Regulatory factor Nef {Human immunodeficiency virus type 1}
awleaqeeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiy
htqgyfpdwqnytpgpgirypltfgwcyklvpvepekleeankddperevlewrfdsrla
fhhmarelhpeyfkna

Timeline for d2nef__:

• d2nef__ first appeared (with stable ids) in SCOP 1.55
  
• d2nef__ appears in SCOP 1.65
  
• d2nef__ appears in SCOP 1.69
  
• d2nef__ appears in the current release, SCOPe 2.08, called d2nefa_