Lineage for d1avva_ (1avv A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
    automatically mapped to Pfam PF00469
  6. Protein Regulatory factor Nef [55673] (1 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)
  8. Domain d1avva_: 1avv A: [40703]

Details for d1avva_

PDB Entry: 1avv (more details), 3 Å

PDB Description: hiv-1 nef protein, unliganded core domain
PDB Compounds: (A:) negative factor

SCOPe Domain Sequences for d1avva_:

Sequence, based on SEQRES records: (download)

>d1avva_ d.102.1.1 (A:) Regulatory factor Nef {Human immunodeficiency virus type 1 [TaxId: 11676]}
vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
rypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrlafhh
varelhpeyf

Sequence, based on observed residues (ATOM records): (download)

>d1avva_ d.102.1.1 (A:) Regulatory factor Nef {Human immunodeficiency virus type 1 [TaxId: 11676]}
vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
rypltfgwcyklvpevlewrfdsrlafhhvarelhpeyf

SCOPe Domain Coordinates for d1avva_ are not available.

Timeline for d1avva_: